PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.095090.2
Common NameCsa_4G012390, LOC101219926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 215aa    MW: 24440.2 Da    PI: 9.3047
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.095090.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.66.1e-29135192159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fp sYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  Cucsa.095090.2 135 LDDGYRWRKYGQKAVKNNKFP-SYYRCTHQGCKVKKQVQRLTRDEGVVVTTYEGIHSHP 192
                     59*******************.9***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-30120192IPR003657WRKY domain
SuperFamilySSF1182907.32E-26127193IPR003657WRKY domain
PROSITE profilePS5081126.372130194IPR003657WRKY domain
SMARTSM007741.4E-33135193IPR003657WRKY domain
PfamPF031066.9E-23136192IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MMENFPSFLS TSSSSSALSL QQILFSRASN HGGDHFRQPP FVSDGFPILF RDVSTDDMSF  60
DATSSVKDDD RNNVAVSVST ERFRVDGSSG RSGVVEYGLK KEEGEGRGRG EDCDKKKKMR  120
NRRFAFQTRS QVDILDDGYR WRKYGQKAVK NNKFPSYYRC THQGCKVKKQ VQRLTRDEGV  180
VVTTYEGIHS HPIEKSTDNF EHILSQMQIY TTSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-25125191774Probable WRKY transcription factor 4
2lex_A9e-25125191774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818745e-78LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132615e-78LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152302.21e-137PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA24e-54WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0A0KU501e-137A0A0A0KU50_CUCSA; Uncharacterized protein
STRINGSi026859m3e-57(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-54WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]